PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS68364.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family BES1
Protein Properties Length: 328aa    MW: 34582.8 Da    PI: 9.9892
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS68364.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822210.73.8e-65251661141
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslqssl 98 
                 gg++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc eAGw+ve+DGttyrkg  ++   ++ +g+sa+++p+ss + s+
  EPS68364.1  25 GGGRRKPSWRERENNRRRERRRRAIAAKIYSGLRAQGNYNLPKHCDNNEVLKALCSEAGWIVEPDGTTYRKGGWRPsPVEQLGGTSATITPSSSRNPSP 123
                 689********************************************************************987775889999**************** PP

      DUF822  99 kssalaspvesysaspksssfpspssldsislasaasllpvls 141
                  ss++asp++sy++sp+sssfpsps+ d + +a+  s+ p+  
  EPS68364.1 124 PSSYFASPIPSYQPSPTSSSFPSPSRHDAAAAANGLSSHPFAF 166
                 *****************************99987755555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.5E-6026157IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009741Biological Processresponse to brassinosteroid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MLWEAGGSTA SSAEGGGGGA AGGGGGGRRK PSWRERENNR RRERRRRAIA AKIYSGLRAQ  60
GNYNLPKHCD NNEVLKALCS EAGWIVEPDG TTYRKGGWRP SPVEQLGGTS ATITPSSSRN  120
PSPPSSYFAS PIPSYQPSPT SSSFPSPSRH DAAAAANGLS SHPFAFLLNS SSCLPPLRIS  180
NSAPVTPPLS SPRKLQKKAI NLEDALAKGS LNVLPFFFAA SSAPASPIRV QRFTPLTIPE  240
CDESDSSTVD SGRWLNFQAY ANAVSSRGIP TSPTFNLIKP PPPLPPPRAA AAAAAAAAQE  300
AMMVAVKPWE GERIHDVGMD DLELTLGN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12746RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-120PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3072e-96BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLS8CMJ60.0S8CMJ6_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000398791e-110(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-76BES1 family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]